monitoraeo
AEO Rankings · Marketing

AEO for digital marketing agencies in Inner North Melbourne: AI search visibility ranking

How AI search engines rank digital marketing agencies in Inner North Melbourne by visibility and citations. 20 brands measured monthly across Google AI Mode: which brands the AI names in answers, which domains it cites as sources, and how the leaders compare. Digital marketing agencies serving Inner North Melbourne businesses with paid media, SEO, social media, creative, email, conversion optimisation, and full-funnel growth support across Melbourne's inner north. Composite score: 70% visibility (% of AI answers naming the brand) + 30% citation rate (% citing the brand's domain). Full methodology →

1%
Avg visibility across category
2%
Avg citation rate
20/20
Brands successfully audited
X LinkedIn

When buyers ask AI engines about Digital marketing agencies in Inner North Melbourne, Digital Nomads HQ stands out as the leader. Alongside it, Online Marketing Gurus and Impressive are also recognized as top brands. Despite having a leader visibility percentage of 0.0, Digital Nomads HQ has a citation percentage of 37.5, indicating its prominence in AI responses.

The rankings are heavily influenced by the sources these AI engines draw from, with top-cited domains including google.com, reddit.com, olivemarketing.me, digitalagencynetwork.com, and sortlist.com. Many of these are aggregator or review sites, which suggests that AI engines value information compiled from various perspectives and user reviews.

For a buyer reading this page, it's crucial to consider how AI engines prioritize brands with recent reviews, strong third-party validation, and topical authority. Therefore, pay attention to agencies with a well-rounded presence across cited domains, as this can indicate reliability and quality of service in the specific subcategory of digital marketing.

At a glance

Category leader Online Marketing Gurus 12% visibility · named in 1 of 8 AI answers
Most cited brand Digital Nomads HQ 38% citation rate · the AI's most-trusted source brand in digital marketing agencies in Inner North Melbourne
Top cited domain google.com Referenced by AI across the digital marketing agencies in Inner North Melbourne query set — the highest-leverage PR target in this category
Visibility spread 12pp Gap between top and bottom of the ranking · 19 brands at 0% (invisible to the AI)

What we observed in this category

Digital Nomads HQ holds rank 1 with a composite score of 11.2, yet its visibility sits at 0.0%, well below the category average of 0.6%. Its position is driven entirely by a 37.5% citation rate, the highest in the category by a wide margin. Online Marketing Gurus at rank 2 shows the inverse pattern with 12.5% visibility and 0.0% citations, producing a composite of 8.8. The gap between these two and rank 3 Impressive (3.8) is steep, and ranks 4 through 10 all score 0.0.

The data reveals a sharp split between brands that are named and those that are trusted as sources. Digital Nomads HQ is cited heavily but never surfaced in direct visibility responses, meaning Google AI Mode references it as a source without actively presenting it as a recommended answer. Online Marketing Gurus appears in AI responses but earns zero citations, making it visible but not authoritative in the AI's sourcing logic. Impressive occupies a modest middle position with 12.5% citations and no visibility.

Google AI Mode is the top engine for every brand in this category without exception. The top cited external sources include google.com, reddit.com, sortlist.com, clutch.co, and digitalagencynetwork.com, indicating the AI anchors heavily on review aggregators and community platforms rather than agency-owned domains. Third-party listing and comparison sites such as clutch.co and sortlist.com appear alongside local directories like melbournewebdigital.com.au and wdmagency.com.au, suggesting structured local content on those platforms carries weight in how the AI constructs its responses.

Movers & shakers since last refresh

Biggest visibility fallers

  • Soup Agency 25% → 0% · rank #1 → #5
    -25pp
  • Clearwater Agency 25% → 0% · rank #2 → #6
    -25pp
  • Digital Nomads HQ 12% → 0% · rank #3 → #1
    -12pp

The AEO ranking

# Brand Visibility Citation Top engine
1
digitalnomadshq.com.au
0% 38% Google AI Mode

Digital Nomads HQ leads with a 37.5% citation rate and a composite of 11.2, but its 0.0% visibility means it is referenced by AI rather than recommended to users.

2
onlinemarketinggurus.com.au
12% 0% Google AI Mode

Online Marketing Gurus is the only brand with measurable visibility at 12.5%, yet its 0.0% citation rate means AI surfaces it without treating its domain as a credible source.

3
impressive.com.au
0% 12% Google AI Mode

Impressive holds rank 3 with a 12.5% citation rate and 0.0% visibility, scoring 3.8 composite, well below the top two but ahead of the seven brands scoring zero.

4
megaphone.com.au
0% 0% Google AI Mode

Megaphone Marketing scores 0.0 across all three metrics, placing it among seven brands with no measurable AI presence in this category at the time of audit.

5
soupagency.com.au
0% 0% Google AI Mode

Soup Agency fell from rank 1 to rank 5 with a visibility delta of -25.0%, losing all prior visibility while its citation rate held flat at 0.0% across both periods.

6
clearwateragency.com.au
0% 0% Google AI Mode
7
rocketagency.com.au
0% 0% Google AI Mode
8
kingkong.co
0% 0% Google AI Mode
9
webprofits.com.au
0% 0% Google AI Mode
10
sparro.com.au
0% 0% Google AI Mode
11
firstpage.com.au
0% 0% Google AI Mode
12
luminary.com
0% 0% Google AI Mode
13
advisible.com.au
0% 0% Google AI Mode
14
purebold.com
0% 0% Google AI Mode
15
humandigital.com.au
0% 0% Google AI Mode
16
makemywebsite.com.au
0% 0% Google AI Mode
17
pattern.com
0% 0% Google AI Mode
18
yoghurtdigital.com.au
0% 0% Google AI Mode
19
sydneydigitalmarketing.com.au
0% 0% Google AI Mode
20
willshall.com
0% 0% Google AI Mode

Sources AI engines trust in this category

Across the 8 buyer-intent queries we ran on digital marketing agencies in Inner North Melbourne, these are the domains Google AI Mode cited most often. If you're not on this list — or if your competitors are — that's a concrete PR / linkbuilding target.

google.comreddit.comolivemarketing.medigitalagencynetwork.comsortlist.commelbournewebdigital.com.auclutch.cowdmagency.com.au

How to read this AEO ranking

Four things worth knowing before you act on the numbers above. These are the same definitions across every industry page — for category-specific observations, see the What we observed section above (where available) and the per-brand insights inline in the ranking.

Visibility = being named

A brand's visibility % is the share of AI answers that mention it by name in the response prose. This is who AI engines actively recommend to the buyer. More on visibility →

Citation rate = being trusted

Citation rate is the share of AI answers that include the brand's domain as a clickable source link. This is what the AI treats as authoritative evidence, different from being named. More on citation rate →

Top engine differs by brand

The "top engine" column shows which AI surface each brand performs best on. Big gaps between a brand's score across engines usually points to specific content or schema gaps. How AI engines pick sources →

AEO rankings move month to month

AI engines re-crawl and re-rank on shorter cycles than classical search. We re-audit every brand on this list at least every 30 days and refresh this page automatically. How AI search ranking works →

Run an AEO audit on your own digital marketing agencies in Inner North Melbourne brand

The brands above were curated from public market-leader lists. Want the same answer engine optimisation measurement against your own brand — including the queries you appear on, which competitors get named instead, and a prioritised fix list? Run a free preview.

Audit your digital marketing agencies in Inner North Melbourne brand → Browse all AEO rankings Methodology →

Frequently asked about AEO for digital marketing agencies in Inner North Melbourne

Who leads AI visibility in digital marketing agencies in Inner North Melbourne?

Digital Nomads HQ holds rank 1 with a composite score of 11.2, driven by a 37.5% citation rate. However, Online Marketing Gurus is the only brand with actual visibility in AI responses at 12.5%.

What is the overall level of AI visibility for agencies in this category?

The category average visibility is just 0.6% and average citation rate is 2.5%, indicating that AI coverage for Inner North Melbourne digital marketing agencies is extremely thin across the board.

What sources does Google AI Mode cite most for this category?

The top cited sources include google.com, reddit.com, sortlist.com, clutch.co, and digitalagencynetwork.com, with local directories such as melbournewebdigital.com.au and wdmagency.com.au also appearing.

Which brands have lost the most AI visibility recently in this category?

Soup Agency and Clearwater Agency each fell four rank positions with a visibility delta of -25.0%, dropping from ranks 1 and 2 respectively to ranks 5 and 6 with zero current visibility.

Can a brand have high citations but zero visibility in Google AI Mode?

Yes. Digital Nomads HQ demonstrates this exactly, with a 37.5% citation rate and 0.0% visibility, meaning Google AI Mode uses its content as a source without surfacing the brand in direct answer responses.

Which engine dominates AI visibility for this category?

Google AI Mode is listed as the top engine for every single brand in the audit, with no other engine appearing in the data for this category.